| Entry |
Rhacophorin-2 |
| Uniprot code |
F1AQK4 |
| Fasta |
F1AQK4 |
| Peptide names |
Rhacophorin-2 |
| Suborder |
Neobatrachia |
| Family |
Rhacophoridae |
| Genus |
Rhacophorus |
| Species |
Rhacophorus feae |
| Ecozone |
Indomalaya |
| Distribution |
Myanmar through northern Thailand and northern Laos to the northern and central highlands of Vietnam, and southwestern Yunnan, China |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLILFFLGMISMSLCQEERGADEDDGGEMTEEEKRGAFTDLLKGVAKQAGIKI
LGIAQCKLAKTC
|
| Length |
72 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKKSLLILFFLGMISMSLC |
| | |
| Prepro | | 20 | | QEERGADEDDGGEMTEEEKR | | | | | Bioactive | Rhacophorin-2 | 30 | No | GAFTDLLKGVAKQAGIKILGIAQCKLAKTC | | | |
|