| Entry |
Hainanenin-1-1 |
| Uniprot code |
F2YHN9 |
| Fasta |
F2YHN9 |
| Peptide names |
Hainanensisin-A2 Hainanenin-1-1 Hainanenin-1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Amolops |
| Species |
Amolops hainanensis |
| Ecozone |
Indomalaya |
| Distribution |
High-gradient streams in southwestern and central Hainan Island, China, 80-960 m elevation |
| Antimicrobial & other activities |
antibacterial, antifungal |
| Tissue |
Skin |
| Sequence |
MLPLKKSMLLLFFLGTINLSLCEQERDAEEERRDDEDKRDVEVEKRFALGAVTKLLPSLL
CMITRKC
|
| Length |
67 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
S. Zhang et al. / Peptides (2012) Hainanenins: a novel family of antimicrobial peptides with strong activity from Hainan cascade-frog Amolops hainanensis, Available online 24 January 2012 |