Entry |
Esculentin-2-a04 |
Uniprot code |
G3ETP7 |
Fasta |
G3ETP7 |
Peptide names |
Esculentin-2-a01 Esculentin-2-a02 Esculentin-2-a03 Esculentin-2-a04 |
Suborder |
Neobatrachia |
Family |
Ranidae |
Genus |
Amolops |
Species |
Amolops jingdongensis |
Ecozone |
Palearctic |
Distribution |
Deqing and Zhongdian in north-northwestern Yunnan near the Sichuan border, and Daliangshan in Sichuan, China, 1020?2000 m elevation |
Antimicrobial & other activities |
antibacterial |
Tissue |
Skin |
Sequence |
MFTLKKPILVLFFLGTISLSLCEQERSADEDDGEEIKEEEVKRGIFSLFKTAAKFVGKNL LKEAGKAGLEHLACKVKNEC
|
Length |
80 |
Signal peptide class |
Class-1 |
Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
Signal |
|
22 |
|
MFTLKKPILVLFFLGTISLSLC |
| | |
Prepro | | 21 | | EQERSADEDDGEEIKEEEVKR | | | | Bioactive | Esculentin-2-a04 | 37 | No | GIFSLFKTAAKFVGKNLLKEAGKAGLEHLACKVKNEC | | | |
|