Entry |
Esculentin-2-b03 |
Uniprot code |
G3ETQ0 |
Fasta |
G3ETQ0 |
Peptide names |
Esculentin-2-b01 Esculentin-2-b02 Esculentin-2-b03 |
Suborder |
Neobatrachia |
Family |
Ranidae |
Genus |
Amolops |
Species |
Amolops jingdongensis |
Ecozone |
Palearctic |
Distribution |
Deqing and Zhongdian in north-northwestern Yunnan near the Sichuan border, and Daliangshan in Sichuan, China, 1020?2000 m elevation |
Antimicrobial & other activities |
antibacterial |
Tissue |
Skin |
Sequence |
MFTMKKPMLVLFFLGTISLSLCEEERSADEDDGEEEVKRGLFSIFKTAAKFVGKNLLKQA GKAGLEHLACKAKNEC
|
Length |
76 |
Signal peptide class |
Class-1 |
Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
Signal |
|
22 |
|
MFTMKKPMLVLFFLGTISLSLC |
| | |
Prepro | | 17 | | EEERSADEDDGEEEVKR | | | | Bioactive | Esculentin-2-b03 | 37 | No | GLFSIFKTAAKFVGKNLLKQAGKAGLEHLACKAKNEC | | | |
|