| Entry |
Jindongenin-2 |
| Uniprot code |
G3ETQ3 |
| Fasta |
G3ETQ3 |
| Peptide names |
Jindongenin-2 Jindongenin-2c Jindongenin-2d palustrin-2AJ1 PL2AJ1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Amolops |
| Species |
Amolops jingdongensis |
| Ecozone |
Palearctic |
| Distribution |
Deqing and Zhongdian in north-northwestern Yunnan near the Sichuan border, and Daliangshan in Sichuan, China, 1020?2000 m elevation |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKPLLVLLFLGTVSLSLCEQERAADDDEGEVIEEEVKRGFMDTAKNVAKNVAVTLI
DKLRCKVTGGC
|
| Length |
71 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
Z. Chen et al. / Biochimie 94 (2012) 328-334. Two novel families of antimicrobial peptides from skin secretions of the Chinese torrent frog, Amolops jingdongensis |