| Entry |
Jindongenin-2c |
| Uniprot code |
G3F829 |
| Fasta |
G3F829 |
| Peptide names |
Jindongenin-2 Jindongenin-2c Jindongenin-2d palustrin-2AJ1 PL2AJ1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Amolops |
| Species |
Amolops jingdongensis |
| Ecozone |
Palearctic |
| Distribution |
Deqing and Zhongdian in north-northwestern Yunnan near the Sichuan border, and Daliangshan in Sichuan, China, 1020?2000 m elevation |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTMKKPLLLLLFLGTVSLSLCEQERAADDDEGEVIEEEVKRGFMDTAKNVAKNVAVTLI DKLRCKVTGGC
|
| Length |
71 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTMKKPLLLLLFLGTVSLSLC |
| | |
| Prepro | | 20 | | EQERAADDDEGEVIEEEVKR | | | | | Bioactive | Jindongenin-2c | 29 | No | GFMDTAKNVAKNVAVTLIDKLRCKVTGGC | | | |
|