| Entry |
Dermaseptin AA-2-5 |
| Uniprot code |
O93222 |
| Fasta |
O93222 |
| Peptide names |
Dermaseptin AA-2-5 |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Agalychnis |
| Species |
Agalychnis annae |
| Ecozone |
Neotropic |
| Distribution |
Northern Cordillera de Talamanca, Cordillera de Tilaran and Cordillera Central of Costa Rica, 780-1650 m elevation |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MAFLKKSLFLVLFLAIVPLSICEEEKREEENEEKQEDDDQSEKRGLVSGLLNTAGGLLGD
LLGSLGSLSGGES
|
| Length |
73 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MAFLKKSLFLVLFLAIVPLSIC |
| | |
| Prepro | | 22 | | EEEKREEENEEKQEDDDQSEKR | | | | | Bioactive | Dermaseptin AA-2-5 | 26 | No | GLVSGLLNTAGGLLGDLLGSLGSLSG | | | |
|