Entry |
Dermaseptin AA-3-3 |
Uniprot code |
O93224 |
Fasta |
O93224 |
Peptide names |
Dermaseptin AA-3-3 |
Suborder |
Neobatrachia |
Family |
Hylidae |
Genus |
Agalychnis |
Species |
Agalychnis annae |
Ecozone |
Neotropic |
Distribution |
Northern Cordillera de Talamanca, Cordillera de Tilaran and Cordillera Central of Costa Rica, 780-1650 m elevation |
Antimicrobial & other activities |
antibacterial |
Tissue |
Skin |
Sequence |
MAFLKKSLFLVLFLGMVSLSICEEEKREEENEQEDDEQSEEKRGMFTNMLKGIGKLAGQA ALGAVKTLAGEQ
|
Length |
72 |
Signal peptide class |
Class-1 |
Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
Signal |
|
22 |
|
MAFLKKSLFLVLFLGMVSLSIC |
| | |
Prepro | | 21 | | EEEKREEENEQEDDEQSEEKR | | | | Bioactive | Dermaseptin AA-3-3 | 26 | No | GMFTNMLKGIGKLAGQAALGAVKTLA | | | |
|