| Entry |
Dermaseptin PD-1-5 |
| Uniprot code |
O93451 |
| Fasta |
O93451 |
| Peptide names |
Dermaseptin AA-1-1 Dermaseptin PD-1-5 |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Pachymedusa |
| Species |
Pachymedusa dacnicolor |
| Ecozone |
Neotropic |
| Distribution |
Pacific lowlands of Mexico from southern Sonora south (including the Balsas Depression to the state of Mexico) to the Isthmus of Tehuantepec |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MAFLKKSLFLVLFLGLVPLFLCENEKREGENEKEENDDQSEEKRSLGSFMKGVGKGLATV
GKIVADQFGKLLEAGKG
|
| Length |
77 |
| Signal peptide class |
Class-1 |