Entry |
Dermaseptin PD-3-3 |
Uniprot code |
O93453 |
Fasta |
O93453 |
Peptide names |
Dermaseptin PD-3-3 |
Suborder |
Neobatrachia |
Family |
Hylidae |
Genus |
Pachymedusa |
Species |
Pachymedusa dacnicolor |
Ecozone |
Neotropic |
Distribution |
Pacific lowlands of Mexico from southern Sonora south (including the Balsas Depression to the state of Mexico) to the Isthmus of Tehuantepec |
Antimicrobial & other activities |
antibacterial |
Tissue |
Skin |
Sequence |
MAFLKKSLFLVLFLGLVSLSICEEKRENEDEEEQEDDEQSEEKRGMWSKIKNAGKAAAKA SKKAAGKAALGAVSEALGEQ
|
Length |
80 |
Signal peptide class |
Class-1 |
Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
Signal |
|
22 |
|
MAFLKKSLFLVLFLGLVSLSIC |
| | |
Prepro | | 22 | | EEKRENEDEEEQEDDEQSEEKR | | | | Bioactive | Dermaseptin PD-3-3 | 33 | No | GMWSKIKNAGKAAAKASKKAAGKAALGAVSEAL | | | |
|