| Entry |
Dermaseptin PD-3-6 |
| Uniprot code |
O93454 |
| Fasta |
O93454 |
| Peptide names |
Dermaseptin PD-3-6 DRP-PD-3-6 |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Pachymedusa |
| Species |
Pachymedusa dacnicolor |
| Ecozone |
Neotropic |
| Distribution |
Pacific lowlands of Mexico from southern Sonora south (including the Balsas Depression to the state of Mexico) to the Isthmus of Tehuantepec |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MAFLKKSLFLVLFLALVPLSICEAEKREEENEEKQEDDDESEKKRGVVTDLLNTAGGLLG
NLVGSLSGGER
|
| Length |
71 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
P. Nicolas and C. El Amri / Biochimica et Biophysica Acta 1788 (2009) 1537-1550. The dermaseptin superfamily: a gene-based combinatorial library of antimicrobial peptides |