| Entry |
Dermaseptin PD-3-7 |
| Uniprot code |
O93455 |
| Fasta |
O93455 |
| Peptide names |
Dermaseptin PD-3-7 |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Pachymedusa |
| Species |
Pachymedusa dacnicolor |
| Ecozone |
Neotropic |
| Distribution |
Pacific lowlands of Mexico from southern Sonora south (including the Balsas Depression to the state of Mexico) to the Isthmus of Tehuantepec |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MSFMKKSLLLVLFLGVVSLSNCEEEKGENENEDHEEHHEEKRLLGDLLGQTSKLVNDLTD
TVGSIV
|
| Length |
66 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MSFMKKSLLLVLFLGVVSLSNC |
| | |
| Prepro | | 20 | | EEEKGENENEDHEEHHEEKR | | | | | Bioactive | Dermaseptin PD-3-7 | 24 | No | LLGDLLGQTSKLVNDLTDTVGSIV | | | |
|