| Entry | Preprocaerulein type-3 |
| Uniprot code | P05224 |
| Fasta | P05224 |
| Peptide names | Caerulein Preprocaerulein type-3 |
| Suborder | Mesobatrachia |
| Family | Pipidae |
| Genus | Xenopus |
| Species | Xenopus laevis |
| Ecozone | Afrotropic |
| Distribution | Extreme southern Angola south to Cape Region of Rep. South Africa thence east and north in savanna habitats to north-east-central Central African Republic and southern Sudan and then west to Nigeria; introduced in southern California, Arizona, USA, Mexico, Chile, France, Mexico, Italy, and Java, Indonesia, as well as Ascension Island |
| Antimicrobial & other activities | fall of the blood pressure, contraction of the gall bladder, stimulating acid secretion of the stomach, increasing the pancreatic juice secretion |
| Tissue | Skin |
| Sequence | MFKGILLCVLFAVLSANPLSQPEGFADEERDVRGLASLLGKALKAGLKIGTHFLGGAPQQ REANDERRFADGQQDYTGWMDFGRRDGQQDYTGWMDFGRRDDEDDVNERDVRGFGSFLGK ALKAALKIGANALGGAPQQREANDERRFADGQQDYTGWMDFGRRNGEDD |
| Length | 169 |
| Signal peptide class | Class-4 |
| References: | |
| 2. for other activities | A. Anastasi et al. / British Journal of Pharmacology 38 (1970) 221-228. Presence of caerulein in extracts of the skin of Leptodactylus pentadactylus labyrinthicus and of Xenopus laevis |
| Segment type | Name | Length | Amidated | Sequence | HC50 (μM) | MIC E. coli (μM) | MIC S. aureus (μM) |
| Signal | 26 | MFKGILLCVLFAVLSANPLSQPEGFA | |||||
| Prepro | 46 | DEERDVRGLASLLGKALKAGLKIGTHFLGGAPQQREANDERRFADG | |||||
| Bioactive | Caerulein | 10 | No | QQDYTGWMDF | |||
| Prepro | 5 | GRRDG | |||||
| Bioactive | Caerulein | 10 | No | QQDYTGWMDF | |||
| Prepro | 54 | GRRDDEDDVNERDVRGFGSFLGKALKAALKIGANALGGAPQQREANDERRFADG | |||||
| Bioactive | Caerulein | 10 | No | QQDYTGWMDF |