| Entry | Ranatensin |
| Uniprot code | P08950 |
| Fasta | P08950 |
| Peptide names | Ranatensin |
| Suborder | Neobatrachia |
| Family | Ranidae |
| Genus | Lithobates |
| Species | Lithobates pipiens |
| Ecozone | Nearctic |
| Distribution | Southern Canada (southeastern British Columbia to southern Northern Territory east to Labrador and Nova Scotia) south through eastern Washington eastern Oregon, Nevada and adjacent California to northern Arizona, northern New Mexico (with islolated populations along the Rio Grande south to Las Cruces), thence east-northeast to central Nebraska, Ohio, northern Kentucky, West Virginia, and New England, USA |
| Tissue | Skin |
| Sequence | MTTIPAIGILPIDFLTILLLFSFISHSVCVEFAEDAGELDKSNAFRRQVPQWAVGHFMGK RSLSDDTEQATMYSSRFVESTS |
| Length | 82 |
| Signal peptide class | Class-6 |
| Segment type | Name | Length | Amidated | Sequence | HC50 (μM) | MIC E. coli (μM) | MIC S. aureus (μM) |
| Signal | 27 | MTTIPAIGILPIDFLTILLLFSFISHS | |||||
| Prepro | 20 | VCVEFAEDAGELDKSNAFRR | |||||
| Bioactive | Ranatensin | 11 | No | QVPQWAVGHFM |