| Entry |
Adenoregulin |
| Uniprot code |
P31107 |
| Fasta |
P31107 |
| Peptide names |
Adenoregulin Dermaseptin B2 DRS-B2 |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Phyllomedusa |
| Species |
Phyllomedusa bicolor |
| Ecozone |
Neotropic |
| Distribution |
Amazon Basin in Brazil, Colombia, Bolivia, and Peru; the Guianan region of Venezuela and the Guianas. Possibly to be found in eastern Ecuador |
| Antimicrobial & other activities |
antibacterial, antifungal, antiprotozoa, interaction with adenosin receptors, guanyl-nucleotide exchange factor activity, inducing behavioral depression |
| Tissue |
Skin |
| Sequence |
MAFLKKSLFLVLFLGLVSLSICEEEKRENEDEEEQEDDEQSEMKRGLWSKIKEVGKEAAK
AAAKAAGKAALGAVSEAVGEQ
|
| Length |
81 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
P. Nicolas and C. El Amri / Biochimica et Biophysica Acta 1788 (2009) 1537-1550. The dermaseptin superfamily: a gene-based combinatorial library of antimicrobial peptides. |
| 2. for other activities |
J.W. Daly et al. / PNAS 89 (1992) 10960-10963. Frog secretions and hunting magic in the upper Amazon: Identification of a peptide that interacts with an adenosine receptor; A. Mor and P. Nicolas / European Journal of Biochemistry 219 (1994) 145-154. Isolation and structure of novel defensive peptides from frog skin |