Dermaseptin-2

Entry Dermaseptin-2
Uniprot code P80278
Fasta P80278
Peptide names Dermaseptin-2 Dermaseptin S2 DS2
Suborder Neobatrachia
Family Hylidae
Genus Phyllomedusa
Species Phyllomedusa sauvagii
Ecozone Neotropic
Distribution The Chacoan region of eastern Bolivia, northern Paraguay, Mato Grosso do Sul (Brazil), and northern Argentina
Antimicrobial & other activities antibacterial, antifungal
Tissue Skin
Sequence
Length 34
References:
1. for MIC/HC50 A. Mor et al. / JBC 269 (1994) 31635-31641. The vertebrate peptide antibiotics dermaseptins have overlapping structural features but target specific microorganisms
2. for other activities A. Mor and P. Nicolas / European Journal of Biochemistry 219 (1994) 145-154. Isolation and structure of novel defensive peptides from frog skin


Segment type Name Length Amidated Sequence HC50 (μM) MIC E. coli (μM) MIC S. aureus (μM)
BioactiveDermaseptin-234NoALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ 2.520