| Entry |
Dermaseptin BI |
| Uniprot code |
P80282 |
| Fasta |
P80282 |
| Peptide names |
Dermaseptin BI Dermaseptin B1 DRS-B1 |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Phyllomedusa |
| Species |
Phyllomedusa bicolor |
| Ecozone |
Neotropic |
| Distribution |
Amazon Basin in Brazil, Colombia, Bolivia, and Peru; the Guianan region of Venezuela and the Guianas. Possibly to be found in eastern Ecuador |
| Antimicrobial & other activities |
antibacterial, antifungal, antiprotozoa |
| Tissue |
Skin |
| Sequence |
MDILKKSLFLVLFLGLVSLSICEEEKRENEDEEKQDDEQSEMKRAMWKDVLKKIGTVALH
AGKAALGAVADTISQGEQ
|
| Length |
78 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
P. Nicolas and C. El Amri / Biochimica et Biophysica Acta 1788 (2009) 1537-1550. The dermaseptin superfamily: a gene-based combinatorial library of antimicrobial peptides. The dermaseptin superfamily: a gene-based combinatorial library of antimicrobial peptides |