| Entry |
Gaegurin-4 |
| Uniprot code |
P80398 |
| Fasta |
P80398 |
| Peptide names |
Gaegurin-4 Gaegurin 4 Esculentin-2EM |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Glandirana rugosa |
| Ecozone |
Palearctic |
| Distribution |
Honshu, Shikoku, and Kyushu Islands, Japan; introduced into Hawaii, USA |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTMKKSLLFLFFLGTISLSLCEEERSADEDDGGEMTEEEVKRGILDTLKQFAKGVGKDL
VKGAAQGVLSTVSCKLAKTC
|
| Length |
80 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
S.-W. Chi et al. / BBRC 352 (2007) 592-597. Solution structure and membrane interaction mode of an antimicrobial peptide gaegurin 4 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTMKKSLLFLFFLGTISLSLC |
| | |
| Prepro | | 21 | | EEERSADEDDGGEMTEEEVKR | | | | | Bioactive | Gaegurin-4 | 37 | No | GILDTLKQFAKGVGKDLVKGAAQGVLSTVSCKLAKTC | | 20 | |
|