| Entry |
Dermaseptin-B4 |
| Uniprot code |
P81486 |
| Fasta |
P81486 |
| Peptide names |
Insulin-releasing-peptide Dermaseptin-B4 Dermaseptin B4 Dermaseptin-2 IRS Dermaseptin-TR1 |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Phyllomedusa |
| Species |
Phyllomedusa bicolor |
| Ecozone |
Neotropic |
| Distribution |
Amazon Basin in Brazil, Colombia, Bolivia, and Peru; the Guianan region of Venezuela and the Guianas. Possibly to be found in eastern Ecuador |
| Antimicrobial & other activities |
antibacterial, insulin releasing |
| Tissue |
Skin |
| Sequence |
MAFLKKSLFLVLFLGLVSLSICEEEKRENKDEIEQEDDEQSEEKRALWKDILKNVGKAAG
KAVLNTVTDMVNQGEQ
|
| Length |
76 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
S. Charpentier et al. / The Journal of Biological Chemistry 273 (1998) 14690-14697. Structure, synthesis, and molecular cloning of dermaseptins B, a family of skin peptide antibiotics |
| 2. for other activities |
M. Amiche et al. / Peptides 29 (2008) 2074-2082. A consistent nomenclature of antimicrobial peptides isolated from frogs of the subfamily Phyllomedusinae |