| Entry |
Preprophylloxin |
| Uniprot code |
P81565 |
| Fasta |
P81565 |
| Peptide names |
Phylloxin Preprophylloxin |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Phyllomedusa |
| Species |
Phyllomedusa bicolor |
| Ecozone |
Neotropic |
| Distribution |
Amazon Basin in Brazil, Colombia, Bolivia, and Peru; the Guianan region of Venezuela and the Guianas. Possibly to be found in eastern Ecuador |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MVFLKKSLLLVLFVGLVSLSICEENKREEHEEIEENKEKAEEKRGWMSKIASGIGTFLSG
MQQG
|
| Length |
64 |
| Signal peptide class |
Class-1 |
| References: |
| 2. for other activities |
T.N. Pierre et al. / European Journal of Biochemistry 267 (2000) 370-378. Phylloxin, a novel peptide antibiotic of the dermaseptin family of antimicrobial/opioid peptide precursors |