| Entry |
Kininogen-1 |
| Uniprot code |
P83056 |
| Fasta |
P83056 |
| Peptide names |
[Ala3,Thr6]-bradykinin Kininogen-1 Kininogen-1-associated peptide |
| Suborder |
Archeobatrachia |
| Family |
Bombinatoridae |
| Genus |
Bombina |
| Species |
Bombina variegata |
| Ecozone |
Palearctic |
| Distribution |
Europe excluding the Iberian Peninsula and Italy south of the Po River in Italy, east to western Ukraine and Moldova; introduced into England |
| Antimicrobial & other activities |
contraction of small intestine smooth muscle cells, relaxation of arterial smooth muscle cells, insulin releasing |
| Tissue |
Skin |
| Sequence |
MRLWFCLSFLIILCVEHFPGTLAVERNVPESEEKTEQFLRDLFEISRLQRRPAGFTPFRG
KFHSQSLRGLSETKRIYNAIWPCKHCNKCKPGLLCKK
|
| Length |
97 |
| Signal peptide class |
Class-5 |
| References: |
| 2. for other activities |
T. Chen et al. / European Journal of Biochemistry 269 (2002) 4693-4700. Novel bradykinins and their precursor cDNAs from European yellow-bellied toad (Bombina variegata) skin; L. Marenah et al. / Biological Chemistry 385 (2004) 315-321. Skin secretion of the toad Bombina variegata contains multiple insulin-releasing peptides including bombesin and entirely novel insulinotropic structures |