| Entry |
Tryptophyllin-1 |
| Uniprot code |
P83455 |
| Fasta |
P83455 |
| Peptide names |
Tryptophyllin-1 |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Pachymedusa |
| Species |
Pachymedusa dacnicolor |
| Ecozone |
Neotropic |
| Distribution |
Pacific lowlands of Mexico from southern Sonora south (including the Balsas Depression to the state of Mexico) to the Isthmus of Tehuantepec |
| Antimicrobial & other activities |
relaxation of arterial smooth muscle cells, contraction of small intestinal smooth muscle cells |
| Tissue |
Skin |
| Sequence |
MNFLKKSLFLVLFLGFVSISFCDEEKRQDDDEGNEREEKKEIQEDGNQEERRDKPPAWVP
GK
|
| Length |
62 |
| Signal peptide class |
Class-1 |
| References: |
| 2. for other activities |
T. Chen et al. / Regulatory Peptides 117 (2004) 25-32. Pachymedusa dacnicolor tryptophyllin-1: structural characterization, pharmacological activity and cloning of precursor cDNA |