| Entry |
Bombesin |
| Uniprot code |
P84213 |
| Fasta |
P84213 |
| Peptide names |
Bombesin |
| Suborder |
Archeobatrachia |
| Family |
Bombinatoridae |
| Genus |
Bombina |
| Species |
Bombina variegata |
| Ecozone |
Palearctic |
| Distribution |
Europe excluding the Iberian Peninsula and Italy south of the Po River in Italy, east to western Ukraine and Moldova; introduced into England |
| Antimicrobial & other activities |
contraction of smooth muscle cells, induction of hypothermia, stimulation of DNA replication, releasing of many gastrointestinal hormones, releasing of insulin |
| Tissue |
Skin |
| Sequence |
MSAIPLNRILPLGFLLIFSFISLSSCMEFVEDPNNQGGLNLQQRLGNQWAVGHLMGKKSL
QDTDFEEMESFAKRNVENMKAESERELRHAQLVVRNILEQYLKNMQN
|
| Length |
107 |
| Signal peptide class |
Class-6 |
| References: |
| 2. for other activities |
E.R. Spindel et al. / PNAS 87 (1990) 9813-9817. Cloning of cDNAs encoding amphibian bombesin: evidence for the relationship between bombesin and gastrin-releasing peptide; L. Marenah et al. / Biological Chemistry 385 (2004) 315-321. Skin secretion of the toad Bombina variegata contains multiple insulin-releasing peptides including bombesin and entirely novel insulinotropic structures |