Palustrin-3b

Entry Palustrin-3b
Uniprot code P84262
Fasta P84262
Peptide names Palustrin-3b
Suborder Neobatrachia
Family Ranidae
Genus Lithobates
Species Lithobates palustris
Ecozone Palearctic
Distribution Eastern North America, from southern Quebec through southern Ontario (Canada) south through extreme eastern Minnesota and on to East Texas then east to South Carolina (USA), extreme western Florida, and north to Nova Scotia (Canada)
Antimicrobial & other activities antibacterial
Tissue Skin
Sequence
Length 48
References:
1. for MIC/HC50 Y.J. Basir et al. / Biochimica et Biophysica Acta 1543 (2000) 95-105. Multiple antimicrobial peptides and peptides related to bradykinin and neuromedin N isolated from skin secretions of the pickerel frog, Rana palustris


Segment type Name Length Amidated Sequence HC50 (μM) MIC E. coli (μM) MIC S. aureus (μM)
BioactivePalustrin-3b48NoGIFPKIIGKGIKTGIVNGIKSLVKGVGMKVFKAGLSNIGNTGCNEDEC 1