| Entry |
Phylloseptin-2 |
| Uniprot code |
P84567 |
| Fasta |
P84567 |
| Peptide names |
Phylloseptin-2 Phylloseptin PS2 |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Phyllomedusa |
| Species |
Phyllomedusa hypochondrialis |
| Ecozone |
Neotropic |
| Distribution |
Eastern Colombia east through northern and eastern Venezuela, through the Guianas and throughout Brazilian Amazonia; currently not known from Amazonian Colombia, Peru, Ecuador, or Bolivia |
| Antimicrobial & other activities |
antibacterial, antifungal |
| Tissue |
Skin |
| Sequence |
MAFLKKSLFLVLFLGLATLSICEEEKRETEEEEYNQEEDDKSEEKRFLSLIPHAINAVST
LVHHFG
|
| Length |
66 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
J.M. Resende et al. / Peptides 29 (2008) 1633-1644. Solution NMR structures of the antimicrobial peptides phylloseptin-1, -2, and -3 and biological activity: The role of charges and hydrogen bonding interactions in stabilizing helix conformations |