Entry |
Phylloseptin-2 |
Uniprot code |
P84567 |
Fasta |
P84567 |
Peptide names |
Phylloseptin-2 Phylloseptin PS2 |
Suborder |
Neobatrachia |
Family |
Hylidae |
Genus |
Phyllomedusa |
Species |
Phyllomedusa hypochondrialis |
Ecozone |
Neotropic |
Distribution |
Eastern Colombia east through northern and eastern Venezuela, through the Guianas and throughout Brazilian Amazonia; currently not known from Amazonian Colombia, Peru, Ecuador, or Bolivia |
Antimicrobial & other activities |
antibacterial, antifungal |
Tissue |
Skin |
Sequence |
MAFLKKSLFLVLFLGLATLSICEEEKRETEEEEYNQEEDDKSEEKRFLSLIPHAINAVST LVHHFG
|
Length |
66 |
Signal peptide class |
Class-1 |
References: |
1. for MIC/HC50 |
J.M. Resende et al. / Peptides 29 (2008) 1633-1644. Solution NMR structures of the antimicrobial peptides phylloseptin-1, -2, and -3 and biological activity: The role of charges and hydrogen bonding interactions in stabilizing helix conformations |