| Entry |
Phylloseptin-7 |
| Uniprot code |
P84572 |
| Fasta |
P84572 |
| Peptide names |
Phylloseptin-P1 Phylloseptin-7 Phylloseptin 7 PS-7 |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Phyllomedusa |
| Species |
Phyllomedusa hypochondrialis |
| Ecozone |
Neotropic |
| Distribution |
Eastern Colombia east through northern and eastern Venezuela, through the Guianas and throughout Brazilian Amazonia; currently not known from Amazonian Colombia, Peru, Ecuador, or Bolivia |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MAFLKKSLFLVLFLGLVSLSICEEEKRETEEEENEQEDDDKSEEKRFLSLIPHAINAVSA
IAKHFG
|
| Length |
66 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
A.H. Thompson et al. / Peptides 28 (2007) 1331-1343. A combined mass spectrometric and cDNA sequencing approach to the isolation and characterization of novel antimicrobial peptides from the skin secretions of Phyllomedusa hypochondrialis azurea |