Dermaseptin-3

Entry Dermaseptin-3
Uniprot code P84598
Fasta P84598
Peptide names Dermaseptin-3
Suborder Neobatrachia
Family Hylidae
Genus Phyllomedusa
Species Phyllomedusa hypochondrialis
Ecozone Neotropic
Distribution Eastern Colombia east through northern and eastern Venezuela, through the Guianas and throughout Brazilian Amazonia; currently not known from Amazonian Colombia, Peru, Ecuador, or Bolivia
Antimicrobial & other activities antibacterial
Tissue Skin
Sequence
Length 34


Segment type Name Length Amidated Sequence HC50 (μM) MIC E. coli (μM) MIC S. aureus (μM)
BioactiveDermaseptin-334NoALWKDVLKKIGTVALHAGKAAFGAAADTISQGGS