Brevinin-2GHa

Entry Brevinin-2GHa
Uniprot code P84860
Fasta P84860
Peptide names Brevinin-2GHa
Suborder Neobatrachia
Family Ranidae
Genus Hylarana
Species Hylarana guentheri
Ecozone Indomalaya
Distribution Central Vietnam throughout southern China (north to Yangtze River), including Hainan and Taiwan; introduced onto Guam
Antimicrobial & other activities antibacterial
Tissue Skin
Sequence
Length 34
References:
1. for MIC/HC50 J. Zhou et al. / Peptides 27 (2006) 3077-3084. Purification and characterization of novel antimicrobial peptides from the skin secretion of Hylarana guentheri


Segment type Name Length Amidated Sequence HC50 (μM) MIC E. coli (μM) MIC S. aureus (μM)
BioactiveBrevinin-2GHa34NoGFSSLFKAGAKYLLKSVGKAGAQQLACKAANNCA  4.4