Dermaseptin-3

Entry Dermaseptin-3
Uniprot code P84923
Fasta P84923
Peptide names Dermaseptin-3
Suborder Neobatrachia
Family Hylidae
Genus Phyllomedusa
Species Phyllomedusa tarsius
Ecozone Neotropic
Distribution Amazon Basin in southern Colombia, Ecuador, Peru, and Brazil, with seemingly isolated populations along the lowlands on the eastern side of the Merida Andes as well as in Barinas Province in eastern Venezuela
Antimicrobial & other activities antibacterial
Tissue Skin
Sequence
Length 30


Segment type Name Length Amidated Sequence HC50 (μM) MIC E. coli (μM) MIC S. aureus (μM)
BioactiveDermaseptin-330NoGLFKTLIKGAGKMLGHVAKQFLGSQGQPES