| Entry | Phylloseptin-7 |
| Uniprot code | P85882 |
| Fasta | P85882 |
| Peptide names | Phylloseptin-P1 Phylloseptin-7 Phylloseptin 7 PS-7 |
| Suborder | Neobatrachia |
| Family | Hylidae |
| Genus | Phyllomedusa |
| Species | Phyllomedusa azurea |
| Ecozone | Neotropic |
| Distribution | Chacoan regions of eastern Bolivia (Beni and Santa Cruz provinces), Paraguay, northern Argentina (Salta, eastern Jujuy, Formosa, Chaco, northern Santiago del Estero, Santa Fe, and Corrients provinces) and pantanal and cerrado regions of central and western Brazil (Rondonia, Mato Grosso, Mato Grosso do Sul, Tocantins, Goias, Distrito Federal, Minas Gerais, and Sao Paulo) with an isolated population in Santa Catarina, southern Brazil |
| Antimicrobial & other activities | antibacterial |
| Tissue | Skin |
| Sequence | MAFLKKSLFLVLFLGLVSLSICEEEKRETEEKENEQEDDDKSEEKRFLSLIPHAINAVSA IAKHFG |
| Length | 66 |
| Signal peptide class | Class-1 |
| References: | |
| 1. for MIC/HC50 | A.H. Thompson et al. / Peptides 28 (2007) 1331-1343. A combined mass spectrometric and cDNA sequencing approach to the isolation and characterization of novel antimicrobial peptides from the skin secretions of Phyllomedusa hypochondrialis azurea |
| Segment type | Name | Length | Amidated | Sequence | HC50 (μM) | MIC E. coli (μM) | MIC S. aureus (μM) |
| Signal | 22 | MAFLKKSLFLVLFLGLVSLSIC | |||||
| Prepro | 24 | EEEKRETEEKENEQEDDDKSEEKR | |||||
| Bioactive | Phylloseptin-7 | 19 | Yes | FLSLIPHAINAVSAIAKHF | 7.2 | 3.6 |