Entry | Esculentin-2Rb |
Uniprot code | P86021 |
Fasta | P86021 |
Peptide names | Esculentin-2Rb |
Suborder | Neobatrachia |
Family | Ranidae |
Genus | Rana |
Species | Pelophylax ridibundus |
Ecozone | Palearctic |
Distribution | Central Europe east of northeastern France, north to southern shore of Baltic Sea (and extreme southern Finland), south to extreme northeastern Spain, northern Italy and the Balkans including eastern Greece; east to ca. 81 degrees E in Asiatic Russia, south to western Iran and Afghanistan. Isolated populations in the high Asir region of of western Saudi Arabia, and oases of eastern Saudi Arabia; introduced into England and Italy |
Antimicrobial & other activities | antibacterial |
Tissue | Skin |
Sequence | |
Length | 37 |
Segment type | Name | Length | Amidated | Sequence | HC50 (μM) | MIC E. coli (μM) | MIC S. aureus (μM) |
Bioactive | Esculentin-2Rb | 37 | No | GIFSLVKGVAKLAGKTLAKEGGKFGLELAMCKIAKQC |