| Entry | Esculentin-2Rb |
| Uniprot code | P86021 |
| Fasta | P86021 |
| Peptide names | Esculentin-2Rb |
| Suborder | Neobatrachia |
| Family | Ranidae |
| Genus | Rana |
| Species | Pelophylax ridibundus |
| Ecozone | Palearctic |
| Distribution | Central Europe east of northeastern France, north to southern shore of Baltic Sea (and extreme southern Finland), south to extreme northeastern Spain, northern Italy and the Balkans including eastern Greece; east to ca. 81 degrees E in Asiatic Russia, south to western Iran and Afghanistan. Isolated populations in the high Asir region of of western Saudi Arabia, and oases of eastern Saudi Arabia; introduced into England and Italy |
| Antimicrobial & other activities | antibacterial |
| Tissue | Skin |
| Sequence | |
| Length | 37 |
| Segment type | Name | Length | Amidated | Sequence | HC50 (μM) | MIC E. coli (μM) | MIC S. aureus (μM) |
| Bioactive | Esculentin-2Rb | 37 | No | GIFSLVKGVAKLAGKTLAKEGGKFGLELAMCKIAKQC |