| Entry |
Raniseptin-1 |
| Uniprot code |
P86037 |
| Fasta |
P86037 |
| Peptide names |
Raniseptin-1 Raniseptin Rsp-1 |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Hypsiboas |
| Species |
Hypsiboas raniceps |
| Ecozone |
Neotropic |
| Distribution |
Amazonian Colombia, Venezuela (Amazonas), French Guiana, eastern Brazil, Paraguay, northern Argentina, and eastern Bolivia |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MAFLKKSLFLVLFLGIVSLSICEEEKREGEEEEKQEEENEELSEEELRERRAWLDKLKSL
GKVVGKVALGVAQNYLNPQQ
|
| Length |
80 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
B.S. Magalhaes et al. / BBRC 377 (2008) 1057-1061. Post-secretory events alter the peptide content of the skin secretion of Hypsiboas raniceps |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MAFLKKSLFLVLFLGIVSLSIC |
| | |
| Prepro | | 29 | | EEEKREGEEEEKQEEENEELSEEELRERR | | | | | Bioactive | Raniseptin-1 | 29 | No | AWLDKLKSLGKVVGKVALGVAQNYLNPQQ | | 5 | 20 |
|