| Entry |
Ranakinin-N |
| Uniprot code |
P86093 |
| Fasta |
P86093 |
| Peptide names |
Ranakinin-N [Val1, Thr6]-Bradykinin Bradykinin bradykinin-like protein |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Hylarana |
| Species |
Hylarana nigrovittata |
| Ecozone |
Indomalaya |
| Distribution |
Nepal and West Bengal, Assam. and Meghalaya (India) as well as adjacent Bangladesh to Yunnan and Guangxi (China), Vietnam and south to Malaya |
| Antimicrobial & other activities |
contraction of intestinal smooth muscle, relaxation of arterial smooth muscle, targeting of bradykinin receptors (BDKRB) |
| Tissue |
Skin |
| Sequence |
MFTMKKSLLLLFFLGTISMSLCEEKRDADEEETEGEAKMEDIKRAEAVPPGFTPFRKP
|
| Length |
58 |
| Signal peptide class |
Class-1 |
| References: |
| 2. for other activities |
X. Liu et al. / Journal of Peptide Science 14 (2008) 626-630. A novel bradykinin-like peptide from skin secretions of the frog, Rana nigrovittata |