Entry |
Bombesin |
Uniprot code |
P86483 |
Fasta |
P86483 |
Peptide names |
Bombesin |
Suborder |
Neobatrachia |
Family |
Ranidae |
Genus |
Sanguirana |
Species |
Sanguirana varians |
Ecozone |
Indomalaya |
Distribution |
Yunnan, Guangxi, and Hainan Island, China |
Antimicrobial & other activities |
contraction of stomach smooth muscle cells |
Tissue |
Skin |
Sequence |
MSLLPAVKVLPLGYLGIVLVFSLILRSAMVDFIQDAGKLERIDTYKREAQMIFGAPMWAL GHLMGRK
|
Length |
67 |
Signal peptide class |
Class-6 |
References: |
2. for other activities |
Y. Miao et al. / Comparative Biochemistry and Physiology, Part B 155 (2010) 106-109. A bombesin-like peptide from skin of Sanguirana varians |
Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
Signal |
|
30 |
|
MSLLPAVKVLPLGYLGIVLVFSLILRSAMV |
| | |
Prepro | | 19 | | DFIQDAGKLERIDTYKREA | | | | Bioactive | Bombesin | 15 | No | QMIFGAPMWALGHLM | | | |
|