| Entry |
Bombesin |
| Uniprot code |
P86994 |
| Fasta |
P86994 |
| Peptide names |
Bombesin Bombesin-RS |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Rana shuchinae |
| Ecozone |
Palearctic |
| Distribution |
Southern Sichuan and northern Yunnan, China; likely into adjacent northern Myanmar. |
| Antimicrobial & other activities |
stimulation of smooth muscle cells |
| Tissue |
Skin |
| Sequence |
MLLLSAVKTLLLAWLGIVLVFMSIIKSAMLDFLQEAGKLEGIETYKKEAQTSFMAPSWAL
GHLMGRK
|
| Length |
67 |
| Signal peptide class |
Class-6 |
| References: |
| 2. for other activities |
H. Wang and al. / Mol. Biol. Rep. 38 (2011) 3599-3603. A novel bombesin-like peptide from skin of Rana shuchinae |