| Entry |
Preprodermaseptin S10 |
| Uniprot code |
Q1EN14 |
| Fasta |
Q1EN14 |
| Peptide names |
Preprodermaseptin S10 |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Phyllomedusa |
| Species |
Phyllomedusa sauvagii |
| Ecozone |
Neotropic |
| Distribution |
The Chacoan region of eastern Bolivia, northern Paraguay, Mato Grosso do Sul (Brazil), and northern Argentina |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MAFLKKSLFLVLFLALVPLSICEEEKREGENEKEQEDDNQSEEKRGLVSDLLSTVTGLLG
NLGGGGLKKI
|
| Length |
70 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MAFLKKSLFLVLFLALVPLSIC |
| | |
| Prepro | | 23 | | EEEKREGENEKEQEDDNQSEEKR | | | | | Bioactive | Preprodermaseptin S10 | 25 | No | GLVSDLLSTVTGLLGNLGGGGLKKI | | | |
|