| Entry |
Preprodermaseptin S9 |
| Uniprot code |
Q1EN15 |
| Fasta |
Q1EN15 |
| Peptide names |
Preprodermaseptin S9 Dermaseptin S9 DRS-S9 |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Phyllomedusa |
| Species |
Phyllomedusa sauvagii |
| Ecozone |
Neotropic |
| Distribution |
The Chacoan region of eastern Bolivia, northern Paraguay, Mato Grosso do Sul (Brazil), and northern Argentina |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MAFLKKSLFLVLFLGLVSLSICDEEKRENEDEENQEDDEQSEMRRGLRSKIWLWVLLMIW
QESNKFKKM
|
| Length |
69 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
O. Lequin et al. / Biochemistry 45 (2006) 468-480. Dermaseptin S9, an ?-Helical Antimicrobial Peptide with a Hydrophobic Core and Cationic Termini |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MAFLKKSLFLVLFLGLVSLSIC |
| | |
| Prepro | | 23 | | DEEKRENEDEENQEDDEQSEMRR | | | | | Bioactive | Preprodermaseptin S9 | 24 | No | GLRSKIWLWVLLMIWQESNKFKKM | 175 | 3.1 | |
|