| Entry |
Temporin-1V |
| Uniprot code |
Q1JS91 |
| Fasta |
Q1JS91 |
| Peptide names |
Temporin-1AM Temporin-1PLa Temporin-1V |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana versabilis |
| Ecozone |
Indomalaya |
| Distribution |
Southeastern China, from southern Anhui Jiangxi, and northern Guangdong west to Guizhou |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGTINLSLCEEERDADEEERRDDPDEMNVEVEKRFLPLVGKILSGLI
GK
|
| Length |
62 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
Y.J. Basir et al. / Biochimica et Biophysica Acta 1543 (2000) 95-105. Multiple antimicrobial peptides and peptides related to bradykinin and neuromedin N isolated from skin secretions of the pickerel frog, Rana palustris |