| Entry |
Esculentin-2P |
| Uniprot code |
Q1MU22 |
| Fasta |
Q1MU22 |
| Peptide names |
Esculentin-2P |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Pelophylax |
| Species |
Pelophylax fukienensis |
| Ecozone |
Indomalaya |
| Distribution |
Southeastern China (Jianxi, Fujian) and Taiwan |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFIGTISLSLCEEERNADEEEGGEVQEEEVKRGIFSLIKGAAKVVAKGL
GKEVGKFGLDLMACKVTNQC
|
| Length |
80 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
T. Chen et al. / Genomics 87 (2006) 638-644. Cloning from tissue surrogates: Antimicrobial peptide (esculentin) cDNAs from the defensive skin secretions of Chinese ranid frogs |