| Entry |
Temporin-1TGb |
| Uniprot code |
Q2PGA7 |
| Fasta |
Q2PGA7 |
| Peptide names |
Temporin-1TGb |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Rana tagoi |
| Ecozone |
Palearctic |
| Distribution |
Mountain regions of Honshu, Shikoku, and Kyushu Islands as well as Togoshima in the Oki Archipelago and Yakushima in the Tanegashima Group, Japan |
| Antimicrobial & other activities |
antibacterial, antifungal |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGTINLSLCEEERDADEEERRDDPEEGDVEVEKRAVDLAKIANKVLS
SLFGK
|
| Length |
65 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
A. Ohnuma et al. / General and Comparative Endocrinology 146 (2006) 242-250. Developmental and triiodothyronine-induced expression of genes encoding preprotemporins in the skin of Tago?s brown frog Rana tagoi |