Entry |
Brevinin-1V |
Uniprot code |
Q2UXV8 |
Fasta |
Q2UXV8 |
Peptide names |
Brevinin-1V Brevinin-1V-HN1 |
Suborder |
Neobatrachia |
Family |
Ranidae |
Genus |
Odorrana |
Species |
Odorrana versabilis |
Ecozone |
Indomalaya |
Distribution |
Southeastern China, from southern Anhui Jiangxi, and northern Guangdong west to Guizhou |
Antimicrobial & other activities |
antibacterial |
Tissue |
Skin |
Sequence |
MFTLKKSLLLLFFLGTINLSLCEQERDADEEERRDDSEERDIEVEKRFLPLIASVAANLV PKIFCKITKKC
|
Length |
71 |
Signal peptide class |
Class-1 |
Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
Signal |
|
22 |
|
MFTLKKSLLLLFFLGTINLSLC |
| | |
Prepro | | 25 | | EQERDADEEERRDDSEERDIEVEKR | | | | Bioactive | Brevinin-1V | 24 | No | FLPLIASVAANLVPKIFCKITKKC | | | |
|