| Entry | Maximin-S type D |
| Uniprot code | Q5GC91 |
| Fasta | Q5GC91 |
| Peptide names | Maximin-S1 Maximin-S type D Maximin-S3 Maximin-S5 Maximin-S2 Maximin-S4 |
| Suborder | Archeobatrachia |
| Family | Bombinatoridae |
| Genus | Bombina |
| Species | Bombina maxima |
| Ecozone | Palearctic, Indomalaya |
| Distribution | Yunnan, southwestern Sichuan, Hubei, Guizhou, and northern Guangxi, China; adjacent northern Vietnam |
| Antimicrobial & other activities | antibacterial |
| Tissue | Skin |
| Sequence | MNFNYFILVLFFITSGHAKSETREVHQEAENHIKRGSNTGFNFKTLDKEKRSAEEQNLAE HLVTRGSNKGFNFMVDMINALSNGKRSAEEQDLAEDLVTRGSNKGFNFMVDMIQALSKGK RSAEDQDLAEDLVTRGSNKGFNFMVDMIQALSNGKRSAEEQDLAEHLVTRGSNKGFNFMV DMINALSNGKRSAEEQDLVEDLVTRRSNKGFNFMVDMIQALSKGKRSAEEQDLAEDLVTR GSNKGFNFMVDMIQALSKGKRSAEQEKDMK |
| Length | 270 |
| Signal peptide class | Class-3 |
| Segment type | Name | Length | Amidated | Sequence | HC50 (μM) | MIC E. coli (μM) | MIC S. aureus (μM) |
| Signal | 18 | MNFNYFILVLFFITSGHA | |||||
| Prepro | 17 | KSETREVHQEAENHIKR | |||||
| Bioactive | Maximin-S1 | 14 | No | GSNTGFNFKTLDKE | |||
| Prepro | 16 | KRSAEEQNLAEHLVTR | |||||
| Bioactive | Maximin-S3 | 18 | No | GSNKGFNFMVDMINALSN | |||
| Prepro | 17 | GKRSAEEQDLAEDLVTR | |||||
| Bioactive | Maximin-S5 | 18 | No | GSNKGFNFMVDMIQALSK | |||
| Prepro | 17 | GKRSAEDQDLAEDLVTR | |||||
| Bioactive | Maximin-S2 | 18 | No | GSNKGFNFMVDMIQALSN | |||
| Prepro | 17 | GKRSAEEQDLAEHLVTR | |||||
| Bioactive | Maximin-S3 | 18 | No | GSNKGFNFMVDMINALSN | |||
| Prepro | 17 | GKRSAEEQDLVEDLVTR | |||||
| Bioactive | Maximin-S4 | 18 | No | RSNKGFNFMVDMIQALSK | |||
| Prepro | 17 | GKRSAEEQDLAEDLVTR | |||||
| Bioactive | Maximin-S5 | 18 | No | GSNKGFNFMVDMIQALSK |