| Entry |
Aurein 5.3 |
| Uniprot code |
Q5K0E2 |
| Fasta |
Q5K0E2 |
| Peptide names |
Aurein 5.3 |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Litoria |
| Species |
Litoria aurea |
| Ecozone |
Australasia |
| Distribution |
Eastern New South Wales, south of the Richmond River, Australia; introduced into New Zealand, New Caledonia, and the New Hebrides Island |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MAFLKKSLFLVLFLGLVSLSICEQEKREEENQEEDEENEAASEEKRGLMSSIGKALGGLI
VNVLKPKTPAS
|
| Length |
71 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MAFLKKSLFLVLFLGLVSLSIC |
| | |
| Prepro | | 24 | | EQEKREEENQEEDEENEAASEEKR | | | | | Bioactive | Aurein 5.3 | 25 | No | GLMSSIGKALGGLIVNVLKPKTPAS | | | |
|