| Entry |
Kininogen-1 |
| Uniprot code |
Q800F1 |
| Fasta |
Q800F1 |
| Peptide names |
[Thr6]-phyllokinin Kininogen-1 [Thr6]-bradykinin |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Phyllomedusa |
| Species |
Phyllomedusa sauvagii |
| Ecozone |
Neotropic |
| Distribution |
The Chacoan region of eastern Bolivia, northern Paraguay, Mato Grosso do Sul (Brazil), and northern Argentina |
| Tissue |
Skin |
| Sequence |
MDILKKSLFLVLFLGLVSFSICEEEKRDTEEEENDDEIEEESEEKKREAPERPPGFTPFR
IY
|
| Length |
62 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MDILKKSLFLVLFLGLVSFSIC |
| | |
| Prepro | | 25 | | EEEKRDTEEEENDDEIEEESEEKKR | | | | | Bioactive | [Thr6]-phyllokinin | 11 | No | RPPGFTPFRIY | | | | | Bioactive | [Thr6]-bradykinin | 9 | No | RPPGFTPFR | | | |
|