Entry |
Caerin-1.1 |
Uniprot code |
Q800R2 |
Fasta |
Q800R2 |
Peptide names |
Caerin-1.1 Caerin 1.1 |
Suborder |
Neobatrachia |
Family |
Hylidae |
Genus |
Litoria |
Species |
Litoria caerulea |
Ecozone |
Australasia |
Distribution |
Northern and eastern Australia (except for the Victoria and Tasmania); islands in the Torres Straits; New Guinea (northern lowlands, southern lowlands, and Vogelkop Peninsula); introduced into New Zealand |
Antimicrobial & other activities |
antibacterial, anticancer, antifungal, nNOS inhibitor |
Tissue |
Skin |
Sequence |
MASLKKSLFLVLLLGFVSVSICEEEKRQEDEDEHEEEGESQEEGSEEKRGLLSVLGSVAK HVLPHVVPVIAEHLG
|
Length |
75 |
Signal peptide class |
Class-1 |
References: |
1. for MIC/HC50 |
M.A. Apponyi et al. / Peptides 25 (2004) 1035-1054. Host-defence peptides of Australian anurans: structure, mechanism of action and evolutionary significance; P.A. Wabnitz et al. / European Journal of Biochemistry 267 (2000) 269-275. Differences in the skin peptides of the male and female Australian tree frog Litoria splendida. The discovery of the aquatic male sex pheromone splendipherin, together with phe8 caerulein and a new antibiotic peptide caerin 1.10 |
2. for other activities |
R.J. Jackway et al. / Peptides 32 (2011) 161-172. Skin peptide and cDNA profiling of Australian anurans: genus and species identification and evolutionary trends |