| Entry |
Caerin 1.13 |
| Uniprot code |
Q800R7 |
| Fasta |
Q800R7 |
| Peptide names |
Caerin 1.13 |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Litoria |
| Species |
Litoria caerulea |
| Ecozone |
Australasia |
| Distribution |
Northern and eastern Australia (except for the Victoria and Tasmania); islands in the Torres Straits; New Guinea (northern lowlands, southern lowlands, and Vogelkop Peninsula); introduced into New Zealand |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MASLKKSLFLVLFLGFVSVSICEEEKRQEDEDENEEEGENQEEGSEEKRGLLSVLGSLKL
IVPHVVPLIAEHLG
|
| Length |
74 |
| Signal peptide class |
Class-1 |
| References: |
| 2. for other activities |
D. Vanhoye et a. / European Journal of Biochemistry 270 (2003) 2068-2081. Antimicrobial peptides from hylid and ranin frogs originated from a 150-million-year-old ancestral precursor with a conserved signal peptide but a hypermutable antimicrobial domain |