Peptide leucine arginine

Entry Peptide leucine arginine
Uniprot code Q90WP7
Fasta Q90WP7
Peptide names Peptide leucine arginine
Suborder Neobatrachia
Family Ranidae
Genus Lithobates
Species Lithobates pipiens
Ecozone Nearctic
Distribution Southern Canada (southeastern British Columbia to southern Northern Territory east to Labrador and Nova Scotia) south through eastern Washington eastern Oregon, Nevada and adjacent California to northern Arizona, northern New Mexico (with islolated populations along the Rio Grande south to Las Cruces), thence east-northeast to central Nebraska, Ohio, northern Kentucky, West Virginia, and New England, USA
Antimicrobial & other activities antibacterial, anticancer, antifungal, mast cell degranulation, granulopoiesis inhibition, histamine releasing
Tissue Skin
Sequence MFTLKKSLLLLFFLGTISSSLCEQERDSDDEDQGEVTEQVVKRLVRGCWTKSYPPKPCFV
RG
Length 62
Signal peptide class Class-1
References:
2. for other activities A.L. Salmon et al. / Journal of Biological Chemistry 276 (2001) 10145-10152. Peptide leucine arginine, a potent immunomodulatory peptide isolated and structurally characterized from the skin of the Northern Leopard frog, Rana pipiens;  M.L. Mangoni et al. / Biochemistry 42 (2003) 14023-14035. Ranacyclins, a new family of short cyclic antimicrobial peptides: biological function, mode of action, and parameters involved in target specificity


Segment type Name Length Amidated Sequence HC50 (μM) MIC E. coli (μM) MIC S. aureus (μM)
Signal   22   MFTLKKSLLLLFFLGTISSSLC    
Prepro21 EQERDSDDEDQGEVTEQVVKR   
BioactivePeptide leucine arginine18NoLVRGCWTKSYPPKPCFVR