| Entry |
Dermaseptin DRG1 |
| Uniprot code |
Q90ZK3 |
| Fasta |
Q90ZK3 |
| Peptide names |
Dermaseptin DRG1 |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Phyllomedusa |
| Species |
Phyllomedusa bicolor |
| Ecozone |
Neotropic |
| Distribution |
Amazon Basin in Brazil, Colombia, Bolivia, and Peru; the Guianan region of Venezuela and the Guianas. Possibly to be found in eastern Ecuador |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MASLKKSLFLVLFLGLVSLSICEEEKRENEDEEEQEDDEQSEMKRGLWSNIKTAGKEAAK
AALKAAGKAALGAVTDAVGEQ
|
| Length |
81 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MASLKKSLFLVLFLGLVSLSIC |
| | |
| Prepro | | 23 | | EEEKRENEDEEEQEDDEQSEMKR | | | | | Bioactive | Dermaseptin DRG1 | 33 | No | GLWSNIKTAGKEAAKAALKAAGKAALGAVTDAV | | | |
|