| Entry | PYLa/PGLa B |
| Uniprot code | Q91826 |
| Fasta | Q91826 |
| Peptide names | PYLa/PGLa B PYLa PGLa H PGLa-H |
| Suborder | Mesobatrachia |
| Family | Pipidae |
| Genus | Xenopus |
| Species | Xenopus laevis |
| Ecozone | Afrotropic |
| Distribution | Extreme southern Angola south to Cape Region of Rep. South Africa thence east and north in savanna habitats to north-east-central Central African Republic and southern Sudan and then west to Nigeria; introduced in southern California, Arizona, USA, Mexico, Chile, France, Mexico, Italy, and Java, Indonesia, as well as Ascension Island |
| Antimicrobial & other activities | antibacterial |
| Tissue | Skin |
| Sequence | MYKQIFLCLIIAALCATIMAEASALADADDDDDKRYVRGMASKAGAIAGKIAKVALKALG RRDS |
| Length | 64 |
| Signal peptide class | Class-4 |
| References: | |
| 1. for MIC/HC50 | F. Hou et al. / International Journal of Antimicrobial Agents 38 (2011) 510-515. Isolation and characterisation of a new antimicrobial peptide from the skin of Xenopus laevis |
| Segment type | Name | Length | Amidated | Sequence | HC50 (μM) | MIC E. coli (μM) | MIC S. aureus (μM) |
| Signal | 20 | MYKQIFLCLIIAALCATIMA | |||||
| Prepro | 15 | EASALADADDDDDKR | |||||
| Bioactive | PYLa | 24 | No | YVRGMASKAGAIAGKIAKVALKAL | |||
| Bioactive | PGLa | 21 | No | GMASKAGAIAGKIAKVALKAL | |||
| Bioactive | PGLa-H | 10 | No | KIAKVALKAL | 22.4 | 8.3 |